Sequence Formats & Conversions
FASTA Format
Description line starting by '>' followed by name and then description;
Sequence in standard IUB/IUPAC amino acid and nucleic acid codes 
starting on the next line until description line of next sequence or 
end of file is reached. '-' often represents a gap of indeterminated 
length.

Example:
>albumin of human origin 
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEV
TEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLV  
RPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELR  
[...]

The description line (or header line) is often used to add information,
but there is no formal definition; here just to mention a few usages:
>name
>name description
>name accession description
>namespace|accession.version|name description
>gi|identifier|namespace|accession.version|name description (NCBI)

Example:
>gi|412163|emb|CAA00606.1| albumin [Homo sapiens]
Sequence/Alignment format converter
Reformat sequence as text in columns of fixed width and with numbering
This freeware tool will look for all FASTA files in the specified folder and will merge their content in a single file, generating a standard or custom Multi-FASTA file.
This freeware program will split a multi-FASTA file in multiple standard FASTA files.
SeqVerter is a free sequence file format conversion utility.
Converts input DNA/AA sequence to specified format (Input format is determined automatically).
ReadSeq, biosequence conversion tool, at Indiana University
ReadSeq online sequence format conversion tool at EBI
Readseq online sequence format conversion tool at the NIH Computational Bioscience and Engineering Laboratory.
Convert Genbank to FASTA on the Web Bench
This freeware program will convert GenBank (gbk) file format to FASTA format.
Convert EMBL to FASTA on the Web Bench